PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 858253
Common NameARALYDRAFT_657697
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family ARF
Protein Properties Length: 638aa    MW: 71880.3 Da    PI: 6.8333
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
858253genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B377.41.6e-24114215199
             EEEE-..-HHHHTT-EE--HHH.HTT.......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEE CS
      B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkv 96 
             f kvlt sd++++g +++ +k+a+e+       +  ++ +++l+ ed +g +W++k+i+r++++r++lt+GW+ Fv +++L +gD++vF   + +++el+v+v
  858253 114 FSKVLTASDTSTHGGFSVLRKHATEClppldmtQ--QTPTQELVAEDVHGYQWKFKHIFRGQPRRHLLTTGWSTFVTSKRLVAGDTFVFL--RGEKGELRVGV 212
             88****************************9643..445569************************************************..4499******* PP

             E-S CS
      B3  97 frk 99 
             +r+
  858253 213 RRA 215
             *97 PP

2Auxin_resp112.63.6e-37240319183
  Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                 a ha++tk++F v+Y+Pr+  s+F+++++k+++a+++k+svGmRfkm+fe+eds+err+sGtv+gv+d++p +W++SkWr+L+
      858253 240 ARHATQTKTMFIVYYKPRT--SQFIISLNKYLEAMSNKFSVGMRFKMRFEGEDSPERRYSGTVIGVNDCSP-HWKDSKWRCLE 319
                 6799**************6..9*************************************************.*********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019361.7E-38106243IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.109.3E-42108229IPR015300DNA-binding pseudobarrel domain
CDDcd100172.30E-20112214No hitNo description
PfamPF023622.8E-22114215IPR003340B3 DNA binding domain
PROSITE profilePS5086312.576114216IPR003340B3 DNA binding domain
SMARTSM010191.2E-23114216IPR003340B3 DNA binding domain
PfamPF065075.0E-33240318IPR010525Auxin response factor
PfamPF023092.0E-12497610IPR033389AUX/IAA domain
SuperFamilySSF542774.22E-13517598No hitNo description
PROSITE profilePS5174525.274522622IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009734Biological Processauxin-activated signaling pathway
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 638 aa     Download sequence    Send to blast
MGGGEYLYDE LWKLCSGPLV DVPQAQERVY YFPQGHMEQL EASTQQVDLN TMKPLFVLPP  60
KILCNVMNVS LQAEKDTDEV YAQITLIPVG TEVDGPTSPD PSPPELQRPK VHSFSKVLTA  120
SDTSTHGGFS VLRKHATECL PPLDMTQQTP TQELVAEDVH GYQWKFKHIF RGQPRRHLLT  180
TGWSTFVTSK RLVAGDTFVF LRGEKGELRV GVRRANRQQS SMPSSVISSH SMHLGVLATA  240
RHATQTKTMF IVYYKPRTSQ FIISLNKYLE AMSNKFSVGM RFKMRFEGED SPERRYSGTV  300
IGVNDCSPHW KDSKWRCLEV HWDEPASISR PNKVSPWEIE PFVTSENVPK SVMLKNKRPR  360
QVSEVSALDV GGITASNLWS SVLTQSHEFA QSCITSQWSS PQQCHRDANE DAKKSDWINN  420
SYSVSNVSKD STLNDQMVSP VEQKKPETTT NYRLFGIDLM SSSLAASEEK TAPMRPINIS  480
KPTMDSHSDP KSEISKVSEE KKQEPAEGSP KEVQSKQSSS TRSRTKVQMQ GVPVGRAVDL  540
TALKGYNELI DDIEKLFDIK GELQSRNQWE IVFTDDEGDM MLVGDDPWPE FCNMVKRIFI  600
WSKEEVKKMT PGNQLRMLLT EVETTLTTAS KTDNHTN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldv_A1e-159734219355Auxin response factor 1
4ldw_A1e-159734219355Auxin response factor 1
4ldw_B1e-159734219355Auxin response factor 1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF0821760.0AF082176.1 Arabidopsis thaliana auxin response factor 9 (ARF9) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002869750.10.0predicted protein
SwissprotQ9XED80.0ARFI_ARATH; Auxin response factor 9
TrEMBLD7M8Z20.0D7M8Z2_ARALL; Auxin response factor
STRINGAl_scaffold_0007_17520.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM27642762
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G23980.10.0auxin response factor 9